CJC-1295 no DAC (Mod GRF 1-29) wholesale
Bulk peptide powder in 10-vial kits, for sale in the USA and abroad: price and cost per mg
About CJC-1295 no DAC (Mod GRF 1-29)
GHRH 1-29 with D-Ala2, Gln8, Ala15 and Leu27 substitutions, C-terminal amide: YADAIFTQSY RKVLAQLSAR KLLQDILSR-NH2. 3 vial strengths, 2mg to 10mg, from $94.50 to $174.73 per box of ten, in US dollars (special-order lines from $42.59 a box at 50 boxes). 2 strengths are on the shelf, leaving in 1 to 2 business days; the other is special order, with a 50-box minimum.
Documents Specification sheet Verify a batch How to read the certificate What the purity figure means The mass result, explained
CJC-1295 no DAC (Mod GRF 1-29) price per box, per vial and per mg
| Code | Strength | Per box | Per vial | Per mg | Stock | Order |
|---|---|---|---|---|---|---|
| CND2 | 2mg x 10 vials | $42.59 | $4.26 | $2.130 per mg | Special order, 50-box minimum | |
| CND5 | 5mg x 10 vials | $94.50 | $9.45 | $1.890 per mg | Low stock | |
| CND10 | 10mg x 10 vials | $174.73 | $17.47 | Lowest $1.747 per mg | Low stock |
On the shelf, leaving in 1 to 2 business days: CND5, CND10. The others are special order, with a 50-box minimum.
Ships from the USA: to US addresses at our risk until delivered (DAP), freight included from $1,000 of goods; to Canada and most other countries through the desk · on-shelf lines leave in 1 to 2 business days, then 1 to 3 business days in US transit · COA per batch · proforma in USD, paid by card, Wise, e-Transfer (Canada), Bitcoin or USDT · prices revised
Stock key
- In stock
- on the shelf, leaves in 1 to 2 business days once payment clears
- Low stock
- on the shelf and running low; leaves in 1 to 2 business days
- Ships in 1 week
- on its way in
- Ships in 2 weeks
- on order
- Made to order, 4 weeks
- made for the order, about four weeks
- Special order, 50-box minimum
- brought in on a 50-box minimum rather than held in stock; the desk confirms the date before you pay
Prices are in US dollars per sealed box. Per unit is the box price over the milligrams, millilitres or units in the box.
CJC-1295 no DAC (Mod GRF 1-29) in brief
CJC-1295 no DAC (Mod GRF 1-29) comes in 3 strengths from 2mg to 10mg per vial, each a sealed box of ten, from $94.50 to $174.73 a box for the strengths sold singly. Per mg the spread is narrow: CND10 (10mg x 10 vials) works out at $1.747 per mg against $1.890 per mg for CND5 (5mg x 10 vials), 8 percent less for the same mg, because the vial, the fill and the testing cost about the same whatever the vial holds.
2 of the 3 strengths are on the shelf today (CND5 and CND10) and leave in 1 to 2 business days after payment clears; CND5 and CND10 are running low. CND2 is special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
What CJC-1295 no DAC (Mod GRF 1-29) is
CJC-1295 without DAC, also called modified GRF (1-29), is sermorelin with four residues changed: D-alanine for alanine at position 2, glutamine for asparagine at 8, alanine for glycine at 15 and leucine for methionine at 27. Two of the changes replace the residues that degrade in the parent: asparagine 8 deamidates and methionine 27 oxidises. The same sequence extended at the C-terminus by a lysine carrying the maleimidopropionic DAC group is a line of its own, CJC-1295 with DAC.
The result is a 29-residue amide with no methionine, no asparagine and no tryptophan, so it forms no sulfoxide and has no asparagine to deamidate, where sermorelin has both. Average mass 3368.0. It is moderately hydrophilic and dissolves readily. Three glutamines remain as slow deamidation sites.
Registry and identity
- Tyr-D-Ala-Asp through to Arg-NH2, the 29-residue amide this line is specified as, is PubChem CID 56841945, C152H252N44O42, which works to 3,368.0, and its synonyms include CJC-1295-no DAC acetate and the CAS-format numbers 863288-34-0 and 446036-97-1. PubChem
- FDA's CJC-1295 record (UNII 62RC32V9N7) opens with this same chain, D-alanine at 2, glutamine at 8, alanine at 15 and leucine at 27, then adds lysinamide 30 with a 3-maleimidopropionyl group on its side chain. FDA GSRS
- CJC-1293 (UNII ZZM61DP6TS, CAS 446262-89-1) is the relative on file that keeps sermorelin's asparagine 8, glycine 15 and methionine 27, takes only the D-alanine at 2, and carries the same maleimidopropionyl lysinamide, C162H263N47O46S. FDA GSRS ZZM61DP6TS, FDA GSRS 89243S03TE
- Sermorelin and this chain are only 10.075 apart in monoisotopic mass, 3355.819 against 3365.894 (worked from C149H246N44O42S and C152H252N44O42 with NIST isotope masses), so their 4+ ions, m/z 839.962 and 842.481, lie 2.519 apart. PubChem 16132413, PubChem 56841945, NIST
A listing in these registers identifies a substance; it is not an approval of this line.
CJC-1295 no DAC beside Tesamorelin and Ipamorelin
CJC-1295 no DAC works out at $1.747 per mg at 10mg (CND10), its lowest by the single box. Its neighbours, on price alone: Tesamorelin at $2.180 per mg at 20mg (TSM20), 5,135.9 g/mol, set side by side in CJC-1295 no DAC vs Tesamorelin; Ipamorelin at $0.553 per mg at 10mg (IP10), 711.9 g/mol, set side by side in CJC-1295 no DAC vs Ipamorelin.
Also set side by side: CJC-1295 no DAC vs CJC-1295 with DAC, CJC-1295 no DAC vs Sermorelin and CJC-1295 no DAC vs GHRP-2.
Reading a CJC-1295 no DAC (Mod GRF 1-29) certificate of analysis (COA)
Identity by mass. Average mass 3368.0 (C152H252N44O42). In electrospray the protonated ions come near m/z 3369.0 (singly charged), m/z 1685.0 (doubly charged), m/z 1123.7 (3x charged), m/z 843.0 (4x charged); on our certificates the measured mass is matched to the calculated average mass, within about one unit.
- Oxidation: no methionine, tryptophan or cysteine in the chain, so oxidised forms are not the impurity to expect.
- Deamidation: 3 glutamines. The deamidated form is 0.984 heavier and a little more negatively charged, inside the tolerance of the average-mass line; telling it apart takes a high-resolution mass, which the certificate does not carry.
- Charge: near neutral pH about +4, basic, with 5 basic residues, so it takes multiple charges in electrospray.
Worked out from what the sheet holds for this line; the batch certificate is the record. How to read one, and verify a batch number.
Buy CJC-1295 no DAC (Mod GRF 1-29) in bulk
CJC-1295 no DAC (Mod GRF 1-29) is sold in bulk by the sealed box of ten vials, and every account starts at list price. Two discounts can lower it, the size of one order (from $5,000 of goods) or the account’s tier (from lifetime paid spend), and the better one applies, never both. Priced below on CND10, 10mg x 10 vials, the best-priced strength.
| Discount | Earned by | Off goods | CND10 per box | Per mg |
|---|---|---|---|---|
| List | Every account, any order | none | $174.73 | $1.747 |
| Order size | $5,000 of goods in one order | 5% | $165.99 | $1.660 |
| Order size | $10,000 of goods in one order | 10% | $157.26 | $1.573 |
| Order size | $20,000 of goods in one order | 15% | $148.52 | $1.485 |
| Order size | $50,000 of goods in one order | 20% | $139.78 | $1.398 |
| Silver tier | $5,000 lifetime paid spend | 3% | $169.49 | $1.695 |
| Gold tier | $15,000 lifetime paid spend | 6% | $164.25 | $1.642 |
| Platinum tier | $50,000 lifetime paid spend | 10% | $157.26 | $1.573 |
| Diamond tier | $100,000 lifetime paid spend | 15% | $148.52 | $1.485 |
Thresholds in USD on goods, before freight; the discount is worked out at checkout and shown on the proforma.
Specification
The limits this compound is supplied to.
| Purity | ≥ 98.0 % (RP-HPLC, 220 nm, area normalisation) |
|---|---|
| Identity | ESI-MS against a calculated average mass of 3368.0 |
| Any single related substance | ≤ 1.0 % |
| Water | ≤ 8.0 % (Karl Fischer) |
| Acetate | ≤ 15.0 % (ion chromatography), as the acetate salt |
| Residual solvents | Acetonitrile ≤ 410 ppm; TFA ≤ 1.0 % |
| Net content | Label claim ± 5 % |
| Closure | 2 mL glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | −20 °C, dark and dry; brief ambient transit tolerated |
| Shelf life | 24 months from manufacture; retest date on the batch record |
Order CJC-1295 no DAC (Mod GRF 1-29)
One box of CND5, 5mg x 10 vials, $94.50 a box. Every strength.
Questions about CJC-1295 no DAC (Mod GRF 1-29)
Is Mod GRF 1-29 the same as CJC-1295 no DAC?
Yes. Mod GRF 1-29 and CJC-1295 no DAC are names for the same thing. With DAC and without DAC are two different articles, not two names for one: the DAC group is a maleimidopropionyl lysine on a thirtieth residue, and the line without it is the 29-residue chain on its own. The certificate and the vial label carry CJC-1295 Without DAC, which is the name the batch is released under.
What is the sequence of CJC-1295 no DAC (Mod GRF 1-29)?
YADAIFTQSYRKVLAQLSARKLLQDILSR-NH2, the alanine at position 2 in its D form: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-Arg-Lys-Val-Leu-Ala-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Leu-Ser-Arg-NH2, 29 residues. It is sermorelin’s chain, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, with four residues changed: D-alanine at 2, glutamine at 8, alanine at 15 and leucine at 27. C152H252N44O42, molecular weight (average mass) 3,368.0.
How much does CJC-1295 no DAC (Mod GRF 1-29) cost?
From $94.50 a sealed box of 10 vials, up to $174.73 for the largest strength sold singly, which works out at $1.747 per mg at its best-priced size. CND2 is special order, 50 boxes at least, at $42.59 a box. To a US address, freight is included from $1,000 of goods; below that it is the carrier’s rate for the carton or a flat $35.00, and to another country the desk quotes it; either way the figure is on the proforma before you pay. Every strength and its price per vial is in this page’s price table.
Which CJC-1295 no DAC (Mod GRF 1-29) size is cheapest per mg?
CND10, 10mg x 10 vials, at $1.747 per mg, which is 8 percent less per mg than CND5, at $1.890 per mg. Larger vials cost less per mg across this range, so match the vial to the size of the work first, then compare per mg.
Can I buy a single vial of CJC-1295 no DAC (Mod GRF 1-29)?
No. One sealed box of ten vials is the smallest quantity of a regular line; for CJC-1295 no DAC (Mod GRF 1-29) that is CND5, 5mg x 10 vials, at $94.50. A first order must reach $100 of goods, so CND5 alone takes two boxes ($189.00) or one box beside other lines. CND2 is special order and takes a minimum of 50 boxes. A box is sealed at fill with its batch number on it, and splitting one would break the link between the vials and their certificate.
Which CJC-1295 no DAC (Mod GRF 1-29) strengths are in stock today?
CND5 at $94.50 a box (running low), CND10 at $174.73 a box (running low). CND2 is special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
How is CJC-1295 no DAC (Mod GRF 1-29) stored?
At minus 20 degrees Celsius, dark and dry. Lyophilised powder tolerates a short spell at ambient temperature in transit, which is why boxes ship without ice. Storage and handling.
What is in a box of CJC-1295 no DAC (Mod GRF 1-29)?
Ten sealed vials of one strength, each labelled with the product code, the strength and the batch number; the trade also calls a box a 10-vial kit. CJC-1295 no DAC (Mod GRF 1-29) is supplied as a powder in a sealed glass vial and in no other presentation. Its specification sheet carries the catalogue name, CJC-1295 Without DAC. Boxes are not split.
Is a certificate of analysis (COA) provided for CJC-1295 no DAC (Mod GRF 1-29)?
Yes. For CJC-1295 no DAC (Mod GRF 1-29) the batch certificate reports its purity, net content and identity by mass spectrometry. The other lines on this page are the specification it is made to, and the desk answers for them on a particular batch. The certificate is sent with the shipment, and again on request, and any batch number can be verified on the certificate page.
Is this for human use?
No. Everything here is supplied for laboratory research only, to trade accounts, and is not for human or animal consumption. The research-use page sets out who can buy and what is not sold.