VIP wholesale
Bulk peptide powder in 10-vial kits, for sale in the USA and abroad: price and cost per mg
About VIP
28-residue peptide amide, HSDAVFTDNY TRLRKQMAVK KYLNSILN-NH2. 2 vial strengths, 5mg to 10mg, from $103.88 to $196.33 per box of ten, in US dollars. Special order, with a 50-box minimum.
Documents Specification sheet Verify a batch How to read the certificate What the purity figure means The mass result, explained
VIP price per box, per vial and per mg
| Code | Strength | Per box | Per vial | Per mg | Stock | Order |
|---|---|---|---|---|---|---|
| VIP5 | 5mg x 10 vials | $103.88 | $10.39 | $2.078 per mg | Special order, 50-box minimum | |
| VIP10 | 10mg x 10 vials | $196.33 | $19.63 | Lowest, 50 boxes $1.963 per mg | Special order, 50-box minimum |
Ships from the USA: to US addresses at our risk until delivered (DAP), freight included from $1,000 of goods; to Canada and most other countries through the desk · on-shelf lines leave in 1 to 2 business days, then 1 to 3 business days in US transit · COA per batch · proforma in USD, paid by card, Wise, e-Transfer (Canada), Bitcoin or USDT · prices revised
Stock key
- In stock
- on the shelf, leaves in 1 to 2 business days once payment clears
- Low stock
- on the shelf and running low; leaves in 1 to 2 business days
- Ships in 1 week
- on its way in
- Ships in 2 weeks
- on order
- Made to order, 4 weeks
- made for the order, about four weeks
- Special order, 50-box minimum
- brought in on a 50-box minimum rather than held in stock; the desk confirms the date before you pay
Prices are in US dollars per sealed box. Per unit is the box price over the milligrams, millilitres or units in the box.
VIP in brief
VIP comes in 2 strengths from 5mg to 10mg per vial, each a sealed box of ten, from $103.88 to $196.33 a box. Per mg the spread is narrow: VIP10 (10mg x 10 vials) works out at $1.963 per mg against $2.078 per mg for VIP5 (5mg x 10 vials), 6 percent less for the same mg, because the vial, the fill and the testing cost about the same whatever the vial holds.
Nothing is held on the shelf: every strength is special order, brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
What VIP is
VIP, vasoactive intestinal peptide, is the native human 28-residue amide, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, average mass 3325.9, a member of the same peptide family as GHRH and secretin. It is synthesised on resin and supplied as the acetate.
It carries one methionine, at position 17, which oxidises to the sulfoxide, and three asparagines, at 9, 24 and 28, that deamidate, so the sulfoxide and the deamidated forms are the related substances to expect, and the batch is kept cold and dark. It is basic, with three lysines, at 15, 20 and 21, and two arginines, at 12 and 14.
VIP beside Tesamorelin and Sermorelin
VIP works out at $1.963 per mg at 10mg (VIP10, in 50-box lots), its lowest. Its neighbours: Tesamorelin at $2.180 per mg at 20mg (TSM20), 5,135.9 g/mol, the whole 44-residue GHRH chain, sixteen longer than VIP, capped with trans-3-hexenoyl on tyrosine 1; Sermorelin at $1.486 per mg at 10mg (SMO10, in 50-box lots), 3,357.9 g/mol.
Reading a VIP certificate of analysis (COA)
Identity by mass. Average mass 3325.9 (C147H238N44O42S). In electrospray the protonated ions come near m/z 3326.9 (singly charged), m/z 1663.9 (doubly charged), m/z 1109.6 (3x charged), m/z 832.5 (4x charged); on our certificates the measured mass is matched to the calculated average mass, within about one unit.
- Oxidation: 1 methionine, which oxidises to the sulfoxide. The sulfoxide makes the chain 16 heavier.
- Deamidation: 3 asparagines and 1 glutamine. The deamidated form is 0.984 heavier and a little more negatively charged, inside the tolerance of the average-mass line; telling it apart takes a high-resolution mass, which the certificate does not carry.
- Charge: near neutral pH about +4, basic, with 5 basic residues, so it takes multiple charges in electrospray.
Worked out from what the sheet holds for this line; the batch certificate is the record. How to read one, and verify a batch number.
Buy VIP in bulk
VIP is sold in bulk by the sealed box of ten vials, and every account starts at list price. Two discounts can lower it, the size of one order (from $5,000 of goods) or the account’s tier (from lifetime paid spend), and the better one applies, never both. Priced below on VIP10, 10mg x 10 vials, the best-priced strength.
| Discount | Earned by | Off goods | VIP10 per box | Per mg |
|---|---|---|---|---|
| List | Every account, any order | none | $196.33 | $1.963 |
| Order size | $5,000 of goods in one order | 5% | $186.51 | $1.865 |
| Order size | $10,000 of goods in one order | 10% | $176.70 | $1.767 |
| Order size | $20,000 of goods in one order | 15% | $166.88 | $1.669 |
| Order size | $50,000 of goods in one order | 20% | $157.06 | $1.571 |
| Silver tier | $5,000 lifetime paid spend | 3% | $190.44 | $1.904 |
| Gold tier | $15,000 lifetime paid spend | 6% | $184.55 | $1.846 |
| Platinum tier | $50,000 lifetime paid spend | 10% | $176.70 | $1.767 |
| Diamond tier | $100,000 lifetime paid spend | 15% | $166.88 | $1.669 |
Thresholds in USD on goods, before freight; the discount is worked out at checkout and shown on the proforma.
Specification
The limits this compound is supplied to.
| Purity | ≥ 98.0 % (RP-HPLC, 220 nm, area normalisation) |
|---|---|
| Identity | ESI-MS against a calculated average mass of 3325.9 |
| Any single related substance | ≤ 1.0 % |
| Water | ≤ 8.0 % (Karl Fischer) |
| Acetate | ≤ 15.0 % (ion chromatography), as the acetate salt |
| Residual solvents | Acetonitrile ≤ 410 ppm; TFA ≤ 1.0 % |
| Net content | Label claim ± 5 % |
| Closure | 2 mL glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | −20 °C, dark and dry; brief ambient transit tolerated |
| Shelf life | 24 months from manufacture; retest date on the batch record |
Order VIP
50 boxes of VIP5, 5mg x 10 vials, $103.88 a box. Every strength.
Questions about VIP
What are VIP’s sequence, formula and molecular weight?
HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, the native human 28-residue amide: C147H238N44O42S, molecular weight (average mass) 3,325.9. A formula of C147H237N43O43S, 0.98 heavier, is the free acid rather than the amide, a different molecule from the one this line is specified as.
Where does VIP stand against sermorelin, the GHRH chain beside it?
Both belong to the peptide family VIP shares with GHRH, and they are close in size: VIP is a 28-residue amide at 3,325.9 and sermorelin, GHRH’s opening 29 residues, an amide at 3,357.9, 32.0 heavier. Each has a single methionine, VIP’s at 17 and sermorelin’s at 27, so both can form a sulfoxide. VIP has three asparagines to deamidate against sermorelin’s one, at 8. Both carry five basic residues, lysines and arginines, so both take several charges in electrospray.
How much does VIP cost?
It is sold only by special order, 50 boxes per strength, from $103.88 a sealed box of 10 vials, up to $196.33 for the largest strength, which works out at $1.963 per mg at its best-priced size. The smallest order is 50 boxes of VIP5, $5,194.00 of goods, with freight included to a US address. Every strength and its price per vial is in this page’s price table.
Which VIP size is cheapest per mg?
VIP10, 10mg x 10 vials, at $1.963 per mg, which is 6 percent less per mg than VIP5, at $2.078 per mg. Larger vials cost less per mg across this range, so match the vial to the size of the work first, then compare per mg.
Can I buy a single vial of VIP?
No, and not a single box either. VIP is a special-order line, brought in on a 50-box minimum rather than held in stock, so the smallest order is 50 sealed boxes of one strength: for VIP5, 5mg x 10 vials, that is 50 boxes at $103.88, $5,194.00 of goods. A box is sealed at fill with its batch number on it, and splitting one would break the link between the vials and their certificate.
Which VIP strengths are in stock today?
None today. VIP5 and VIP10 are special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
How is VIP stored?
At minus 20 degrees Celsius, dark and dry. Lyophilised powder tolerates a short spell at ambient temperature in transit, which is why boxes ship without ice. Storage and handling.
What is in a box of VIP?
Ten sealed vials of one strength, each labelled with the product code, the strength and the batch number; the trade also calls a box a 10-vial kit. VIP is supplied as a powder in a sealed glass vial and in no other presentation. Boxes are not split.
Is a certificate of analysis (COA) provided for VIP?
Yes. For VIP the batch certificate reports its purity, net content and identity by mass spectrometry. The other lines on this page are the specification it is made to, and the desk answers for them on a particular batch. The certificate is sent with the shipment, and again on request, and any batch number can be verified on the certificate page.
Is this for human use?
No. Everything here is supplied for laboratory research only, to trade accounts, and is not for human or animal consumption. The research-use page sets out who can buy and what is not sold.