Sermorelin wholesale
Bulk peptide powder in 10-vial kits, for sale in the USA and abroad: price and cost per mg
About Sermorelin
GHRH 1-29, C-terminal amide, YADAIFTNSY RKVLGQLSAR KLLQDIMSR-NH2. 2 vial strengths, 5mg to 10mg, from $79.99 to $148.55 per box of ten, in US dollars. Special order, with a 50-box minimum.
Documents Specification sheet Verify a batch How to read the certificate What the purity figure means The mass result, explained
Sermorelin price per box, per vial and per mg
| Code | Strength | Per box | Per vial | Per mg | Stock | Order |
|---|---|---|---|---|---|---|
| SMO5 | 5mg x 10 vials | $79.99 | $8.00 | $1.600 per mg | Special order, 50-box minimum | |
| SMO10 | 10mg x 10 vials | $148.55 | $14.86 | Lowest, 50 boxes $1.486 per mg | Special order, 50-box minimum |
Ships from the USA: to US addresses at our risk until delivered (DAP), freight included from $1,000 of goods; to Canada and most other countries through the desk · on-shelf lines leave in 1 to 2 business days, then 1 to 3 business days in US transit · COA per batch · proforma in USD, paid by card, Wise, e-Transfer (Canada), Bitcoin or USDT · prices revised
Stock key
- In stock
- on the shelf, leaves in 1 to 2 business days once payment clears
- Low stock
- on the shelf and running low; leaves in 1 to 2 business days
- Ships in 1 week
- on its way in
- Ships in 2 weeks
- on order
- Made to order, 4 weeks
- made for the order, about four weeks
- Special order, 50-box minimum
- brought in on a 50-box minimum rather than held in stock; the desk confirms the date before you pay
Prices are in US dollars per sealed box. Per unit is the box price over the milligrams, millilitres or units in the box.
Sermorelin in brief
Sermorelin comes in 2 strengths from 5mg to 10mg per vial, each a sealed box of ten, from $79.99 to $148.55 a box. Per mg the spread is narrow: SMO10 (10mg x 10 vials) works out at $1.486 per mg against $1.600 per mg for SMO5 (5mg x 10 vials), 7 percent less for the same mg, because the vial, the fill and the testing cost about the same whatever the vial holds.
Nothing is held on the shelf: every strength is special order, brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
What Sermorelin is
Sermorelin is the first 29 residues of human growth-hormone-releasing hormone with an amidated C-terminus, YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2, average mass 3357.9, supplied as the acetate. It is the native sequence, and the parent of the modified GRF and CJC-1295 lines, which alter four of its residues. GHRH itself belongs to the same peptide family as VIP, another line on this list.
Its weak points in the vial are methionine 27, which oxidises to the sulfoxide, and asparagine 8, which deamidates; modified GRF (1-29) replaces both. The sulfoxide is therefore the related substance to expect, and the batch is kept cold and dark. It dissolves readily.
Registry and identity
- The INN sermorelin dates from WHO Proposed INN List 56, and FDA's GSRS files the peptide as UNII 89243S03TE under CAS 86168-78-7, with DrugBank DB00010, ChEBI 9118, MeSH D017337 and PubChem CID 16132413. FDA GSRS
- Sermorelin acetate is a separate entry and the USAN: UNII 00IBG87IQW, CAS 114466-38-5, ChEMBL CHEMBL1201490, named in GSRS growth hormone-releasing factor (human)-(1-29)-peptide amide, acetate (salt), hydrate, with the acetic acid and water given no fixed count. FDA GSRS
- PubChem draws one such salt, sermorelin acetate hydrate (CID 91820622), with one acetic acid and one water, C151H252N44O45S, 3436.0, of which the peptide's 3357.9 is 97.7 percent (worked from the two formulas). PubChem 91820622, PubChem 16132413
- In UniProt's somatoliberin entry (P01286) these 29 residues are 32 to 60 of the precursor, and the native hormone runs on to a leucine amide at 75, its residue 44, so the amide on arginine 29 belongs to sermorelin and not to the hormone. UniProt, FDA GSRS
- Methionine 27 carries the only sulfur in C149H246N44O42S, and as the sulfoxide the chain gains 15.995: worked from that formula with NIST isotope masses, the monoisotopic 4+ ion moves from m/z 839.962 to 843.961 and the 3+ from 1119.614 to 1124.945. PubChem, NIST
A listing in these registers identifies a substance; it is not an approval of this line.
Sermorelin beside Tesamorelin, CJC-1295 no DAC and Ipamorelin
Sermorelin works out at $1.486 per mg at 10mg (SMO10, in 50-box lots), its lowest. Its neighbours, on price alone: Tesamorelin at $2.180 per mg at 20mg (TSM20), 5,135.9 g/mol, set side by side in Sermorelin vs Tesamorelin; CJC-1295 no DAC at $1.747 per mg at 10mg (CND10), 3,368.0 g/mol, set side by side in CJC-1295 no DAC vs Sermorelin; Ipamorelin at $0.553 per mg at 10mg (IP10), 711.9 g/mol, set side by side in Ipamorelin vs Sermorelin.
Reading a Sermorelin certificate of analysis (COA)
Identity by mass. Average mass 3357.9 (C149H246N44O42S). In electrospray the protonated ions come near m/z 3358.9 (singly charged), m/z 1680.0 (doubly charged), m/z 1120.3 (3x charged), m/z 840.5 (4x charged); on our certificates the measured mass is matched to the calculated average mass, within about one unit.
- Oxidation: 1 methionine, which oxidises to the sulfoxide. The sulfoxide makes the chain 16 heavier.
- Deamidation: 1 asparagine and 2 glutamines. The deamidated form is 0.984 heavier and a little more negatively charged, inside the tolerance of the average-mass line; telling it apart takes a high-resolution mass, which the certificate does not carry.
- Charge: near neutral pH about +4, basic, with 5 basic residues, so it takes multiple charges in electrospray.
Worked out from what the sheet holds for this line; the batch certificate is the record. How to read one, and verify a batch number.
Buy Sermorelin in bulk
Sermorelin is sold in bulk by the sealed box of ten vials, and every account starts at list price. Two discounts can lower it, the size of one order (from $5,000 of goods) or the account’s tier (from lifetime paid spend), and the better one applies, never both. Priced below on SMO10, 10mg x 10 vials, the best-priced strength.
| Discount | Earned by | Off goods | SMO10 per box | Per mg |
|---|---|---|---|---|
| List | Every account, any order | none | $148.55 | $1.486 |
| Order size | $5,000 of goods in one order | 5% | $141.12 | $1.411 |
| Order size | $10,000 of goods in one order | 10% | $133.70 | $1.337 |
| Order size | $20,000 of goods in one order | 15% | $126.27 | $1.263 |
| Order size | $50,000 of goods in one order | 20% | $118.84 | $1.188 |
| Silver tier | $5,000 lifetime paid spend | 3% | $144.09 | $1.441 |
| Gold tier | $15,000 lifetime paid spend | 6% | $139.64 | $1.396 |
| Platinum tier | $50,000 lifetime paid spend | 10% | $133.70 | $1.337 |
| Diamond tier | $100,000 lifetime paid spend | 15% | $126.27 | $1.263 |
Thresholds in USD on goods, before freight; the discount is worked out at checkout and shown on the proforma.
Specification
The limits this compound is supplied to.
| Purity | ≥ 98.0 % (RP-HPLC, 220 nm, area normalisation) |
|---|---|
| Identity | ESI-MS against a calculated average mass of 3357.9 |
| Any single related substance | ≤ 1.0 % |
| Water | ≤ 8.0 % (Karl Fischer) |
| Acetate | ≤ 15.0 % (ion chromatography), as the acetate salt |
| Residual solvents | Acetonitrile ≤ 410 ppm; TFA ≤ 1.0 % |
| Net content | Label claim ± 5 % |
| Closure | 2 mL glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | −20 °C, dark and dry; brief ambient transit tolerated |
| Shelf life | 24 months from manufacture; retest date on the batch record |
Order Sermorelin
50 boxes of SMO5, 5mg x 10 vials, $79.99 a box. Every strength.
Questions about Sermorelin
Which amino acids make up Sermorelin’s 29 residues, and which never occur?
Fifteen different amino acids, of the twenty that are coded. Leucine is the most frequent, four times (14, 17, 22, 23); alanine, serine and arginine come three times each, tyrosine, aspartate, isoleucine, lysine and glutamine twice, and phenylalanine, threonine, asparagine, valine, glycine and methionine once. Cysteine, glutamate, histidine, proline and tryptophan never occur. Arginine holds places 11, 20 and 29, lysine places 12 and 21: five basic side chains, which with the uncapped amine on tyrosine 1 outweigh the two aspartates, 3 and 25, by the charge of about +4.
How much does Sermorelin cost?
It is sold only by special order, 50 boxes per strength, from $79.99 a sealed box of 10 vials, up to $148.55 for the largest strength, which works out at $1.486 per mg at its best-priced size. The smallest order is 50 boxes of SMO5, $3,999.50 of goods, with freight included to a US address. Every strength and its price per vial is in this page’s price table.
Which Sermorelin size is cheapest per mg?
SMO10, 10mg x 10 vials, at $1.486 per mg, which is 7 percent less per mg than SMO5, at $1.600 per mg. Larger vials cost less per mg across this range, so match the vial to the size of the work first, then compare per mg.
Can I buy a single vial of Sermorelin?
No, and not a single box either. Sermorelin is a special-order line, brought in on a 50-box minimum rather than held in stock, so the smallest order is 50 sealed boxes of one strength: for SMO5, 5mg x 10 vials, that is 50 boxes at $79.99, $3,999.50 of goods. A box is sealed at fill with its batch number on it, and splitting one would break the link between the vials and their certificate.
Which Sermorelin strengths are in stock today?
None today. SMO5 and SMO10 are special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
How is Sermorelin stored?
At minus 20 degrees Celsius, dark and dry. Lyophilised powder tolerates a short spell at ambient temperature in transit, which is why boxes ship without ice. Storage and handling.
What is in a box of Sermorelin?
Ten sealed vials of one strength, each labelled with the product code, the strength and the batch number; the trade also calls a box a 10-vial kit. Sermorelin is supplied as a powder in a sealed glass vial and in no other presentation. Its specification sheet carries the catalogue name, Sermorelin Acetate. Boxes are not split.
Is a certificate of analysis (COA) provided for Sermorelin?
Yes. For Sermorelin the batch certificate reports its purity, net content and identity by mass spectrometry. The other lines on this page are the specification it is made to, and the desk answers for them on a particular batch. The certificate is sent with the shipment, and again on request, and any batch number can be verified on the certificate page.
Is this for human use?
No. Everything here is supplied for laboratory research only, to trade accounts, and is not for human or animal consumption. The research-use page sets out who can buy and what is not sold.