Cagrilintide wholesale
Bulk peptide powder in 10-vial kits, for sale in the USA and abroad: price and cost per mg
About Cagrilintide
Acylated 37-residue amylin analogue, one disulfide, C-terminal amide and a C20 fatty-diacid side chain. 2 vial strengths, 5mg to 10mg, from $91.00 to $161.80 per box of ten, in US dollars. Special order, with a 50-box minimum.
Documents Specification sheet Verify a batch How to read the certificate What the purity figure means The mass result, explained
Cagrilintide price per box, per vial and per mg
| Code | Strength | Per box | Per vial | Per mg | Stock | Order |
|---|---|---|---|---|---|---|
| CGL5 | 5mg x 10 vials | $91.00 | $9.10 | $1.820 per mg | Special order, 50-box minimum | |
| CGL10 | 10mg x 10 vials | $161.80 | $16.18 | Lowest, 50 boxes $1.618 per mg | Special order, 50-box minimum |
Ships from the USA: to US addresses at our risk until delivered (DAP), freight included from $1,000 of goods; to Canada and most other countries through the desk · on-shelf lines leave in 1 to 2 business days, then 1 to 3 business days in US transit · COA per batch · proforma in USD, paid by card, Wise, e-Transfer (Canada), Bitcoin or USDT · prices revised
Stock key
- In stock
- on the shelf, leaves in 1 to 2 business days once payment clears
- Low stock
- on the shelf and running low; leaves in 1 to 2 business days
- Ships in 1 week
- on its way in
- Ships in 2 weeks
- on order
- Made to order, 4 weeks
- made for the order, about four weeks
- Special order, 50-box minimum
- brought in on a 50-box minimum rather than held in stock; the desk confirms the date before you pay
Prices are in US dollars per sealed box. Per unit is the box price over the milligrams, millilitres or units in the box.
Cagrilintide in brief
Cagrilintide comes in 2 strengths from 5mg to 10mg per vial, each a sealed box of ten, from $91.00 to $161.80 a box. Per mg the spread is narrow: CGL10 (10mg x 10 vials) works out at $1.618 per mg against $1.820 per mg for CGL5 (5mg x 10 vials), 11 percent less for the same mg, because the vial, the fill and the testing cost about the same whatever the vial holds.
Nothing is held on the shelf: every strength is special order, brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
What Cagrilintide is
Cagrilintide is a synthetic acylated analogue of amylin, the 37-residue pancreatic peptide, with several residues drawn from salmon calcitonin and a C20 fatty diacid attached at the N-terminal end through a gamma-glutamate linker, with no polyethylene-glycol spacer. Like amylin it has a disulfide-bridged ring near the N-terminus and an amidated C-terminus.
It is supplied here on its own and in three co-formulated strengths with semaglutide: Cagrilintide 2.5mg + Semaglutide 2.5mg, Cagrilintide 5mg + Semaglutide 5mg and Cagrilintide 10mg + Semaglutide 10mg. On the certificate the identity line is the lipidated mass and purity is by reverse-phase HPLC; an unclosed bridge makes the chain two mass units heavier, a scrambled one keeps the mass, so ask the desk how a batch’s disulfide was confirmed.
Registry and identity
- Proposed in WHO INN List 123 and a USAN as well, cagrilintide is filed by FDA's GSRS as UNII AO43BIF1U8 under CAS 1415456-99-3, and PubChem holds the structure as CID 171397054, C194H312N54O59S2, with the code NN0174-0833 among its synonyms. FDA GSRS, PubChem
- Its 37 residues, KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP, end in prolinamide with cysteines 2 and 7 joined by a disulfide, and the C20 diacid (19-carboxy-1-oxononadecyl) sits on an L-gamma-glutamyl unit bonded to the alpha-amine of lysine 1, which leaves that lysine's side-chain amine free. FDA GSRS, PubChem
- Set against human amylin, residues 34 to 70 of UniProt P10997, the chain differs at six of its 37 positions: glutamate for asparagine 14, arginine for valine 17, proline for alanine 25 and for serines 28 and 29, and prolinamide in place of the tyrosinamide at 37. UniProt, FDA GSRS
- With tyrosine 37 gone the chain holds no tyrosine or tryptophan, only phenylalanines 15 and 23, so it absorbs little at 280 nm and its purity is read at 210 to 220 nm, while asparagines 3, 21, 22, 31 and 35 and glutamine 10 are the places where deamidation can occur. FDA GSRS
- A hydrochloride is filed separately, cagrilintide hydrochloride (USAN), as UNII 3SBY6D7WH7 with CAS 2341678-33-7, and GSRS lists NNC0174-0833 hydrochloride among its codes. FDA GSRS
A listing in these registers identifies a substance; it is not an approval of this line.
Cagrilintide beside Semaglutide
Cagrilintide works out at $1.618 per mg at 10mg (CGL10, in 50-box lots), its lowest. Its neighbour, on price alone: Semaglutide at $0.301 per mg at 30mg (SM30), 4,113.6 g/mol, set side by side in Cagrilintide vs Semaglutide.
Reading a Cagrilintide certificate of analysis (COA)
Identity by mass. Average mass 4409.1 (C194H312N54O59S2). In electrospray the protonated ions come near m/z 4410.1 (singly charged), m/z 2205.5 (doubly charged), m/z 1470.7 (3x charged), m/z 1103.3 (4x charged); on our certificates the measured mass is matched to the calculated average mass, within about one unit.
- Its mass, 4,409.1, includes the N-terminal lipid, which puts it far from native amylin’s.
Worked out from what the sheet holds for this line; the batch certificate is the record. How to read one, and verify a batch number.
Buy Cagrilintide in bulk
Cagrilintide is sold in bulk by the sealed box of ten vials, and every account starts at list price. Two discounts can lower it, the size of one order (from $5,000 of goods) or the account’s tier (from lifetime paid spend), and the better one applies, never both. Priced below on CGL10, 10mg x 10 vials, the best-priced strength.
| Discount | Earned by | Off goods | CGL10 per box | Per mg |
|---|---|---|---|---|
| List | Every account, any order | none | $161.80 | $1.618 |
| Order size | $5,000 of goods in one order | 5% | $153.71 | $1.537 |
| Order size | $10,000 of goods in one order | 10% | $145.62 | $1.456 |
| Order size | $20,000 of goods in one order | 15% | $137.53 | $1.375 |
| Order size | $50,000 of goods in one order | 20% | $129.44 | $1.294 |
| Silver tier | $5,000 lifetime paid spend | 3% | $156.95 | $1.569 |
| Gold tier | $15,000 lifetime paid spend | 6% | $152.09 | $1.521 |
| Platinum tier | $50,000 lifetime paid spend | 10% | $145.62 | $1.456 |
| Diamond tier | $100,000 lifetime paid spend | 15% | $137.53 | $1.375 |
Thresholds in USD on goods, before freight; the discount is worked out at checkout and shown on the proforma.
Specification
The limits this compound is supplied to.
| Purity | ≥ 98.0 % (RP-HPLC, 220 nm, area normalisation) |
|---|---|
| Identity | ESI-MS against a calculated average mass of 4409.1 |
| Any single related substance | ≤ 1.0 % |
| Water | ≤ 8.0 % (Karl Fischer) |
| Acetate | ≤ 15.0 % (ion chromatography), as the acetate salt |
| Residual solvents | Acetonitrile ≤ 410 ppm; TFA ≤ 1.0 % |
| Net content | Label claim ± 5 % |
| Closure | 2 mL glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | −20 °C, dark and dry; brief ambient transit tolerated |
| Shelf life | 24 months from manufacture; retest date on the batch record |
Order Cagrilintide
50 boxes of CGL5, 5mg x 10 vials, $91.00 a box. Every strength.
Questions about Cagrilintide
How many prolines does Cagrilintide carry, and does human amylin have any?
Four: one at 25, a pair at 28 and 29, then the prolinamide at 37 that closes the chain. Human amylin has none, for each of the four stands where cagrilintide departs from it: amylin carries alanine at 25, serines at 28 and 29, a tyrosinamide at 37. The other two changes swap asparagine 14 for glutamate and valine 17 for arginine, so 31 residues, the ring its two cysteines close among them, are amylin’s own.
How much does Cagrilintide cost?
It is sold only by special order, 50 boxes per strength, from $91.00 a sealed box of 10 vials, up to $161.80 for the largest strength, which works out at $1.618 per mg at its best-priced size. The smallest order is 50 boxes of CGL5, $4,550.00 of goods, with freight included to a US address. Every strength and its price per vial is in this page’s price table.
Which Cagrilintide size is cheapest per mg?
CGL10, 10mg x 10 vials, at $1.618 per mg, which is 11 percent less per mg than CGL5, at $1.820 per mg. Larger vials cost less per mg across this range, so match the vial to the size of the work first, then compare per mg.
Can I buy a single vial of Cagrilintide?
No, and not a single box either. Cagrilintide is a special-order line, brought in on a 50-box minimum rather than held in stock, so the smallest order is 50 sealed boxes of one strength: for CGL5, 5mg x 10 vials, that is 50 boxes at $91.00, $4,550.00 of goods. A box is sealed at fill with its batch number on it, and splitting one would break the link between the vials and their certificate.
Which Cagrilintide strengths are in stock today?
None today. CGL5 and CGL10 are special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
How is Cagrilintide stored?
At minus 20 degrees Celsius, dark and dry. Lyophilised powder tolerates a short spell at ambient temperature in transit, which is why boxes ship without ice. Storage and handling.
What is in a box of Cagrilintide?
Ten sealed vials of one strength, each labelled with the product code, the strength and the batch number; the trade also calls a box a 10-vial kit. Cagrilintide is supplied as a powder in a sealed glass vial and in no other presentation. Boxes are not split.
Is a certificate of analysis (COA) provided for Cagrilintide?
Yes. For Cagrilintide the batch certificate reports its purity, net content and identity by mass spectrometry. The other lines on this page are the specification it is made to, and the desk answers for them on a particular batch. The certificate is sent with the shipment, and again on request, and any batch number can be verified on the certificate page.
Is this for human use?
No. Everything here is supplied for laboratory research only, to trade accounts, and is not for human or animal consumption. The research-use page sets out who can buy and what is not sold.