LL-37 wholesale
Bulk peptide powder in 10-vial kits, for sale in the USA and abroad: price and cost per mg
About LL-37
Cathelicidin 37-residue peptide, LLGDFFRKSK EKIGKEFKRI VQRIKDFLRN LVPRTES. One vial strength, $46.75 per box of ten, in US dollars. Special order, with a 50-box minimum.
Documents Specification sheet Verify a batch How to read the certificate What the purity figure means The mass result, explained
LL-37 price per box, per vial and per mg
| Code | Strength | Per box | Per vial | Per mg | Stock | Order |
|---|---|---|---|---|---|---|
| 375 | 5mg x 10 vials | $46.75 | $4.68 | $0.935 per mg | Special order, 50-box minimum |
Ships from the USA: to US addresses at our risk until delivered (DAP), freight included from $1,000 of goods; to Canada and most other countries through the desk · on-shelf lines leave in 1 to 2 business days, then 1 to 3 business days in US transit · COA per batch · proforma in USD, paid by card, Wise, e-Transfer (Canada), Bitcoin or USDT · prices revised
Stock key
- In stock
- on the shelf, leaves in 1 to 2 business days once payment clears
- Low stock
- on the shelf and running low; leaves in 1 to 2 business days
- Ships in 1 week
- on its way in
- Ships in 2 weeks
- on order
- Made to order, 4 weeks
- made for the order, about four weeks
- Special order, 50-box minimum
- brought in on a 50-box minimum rather than held in stock; the desk confirms the date before you pay
Prices are in US dollars per sealed box. Per unit is the box price over the milligrams, millilitres or units in the box.
LL-37 in brief
LL-37 comes in one strength, 5mg x 10 vials, at $46.75 for the box of ten ($4.68 a vial, $0.935 per mg).
Nothing is held on the shelf: this is a special-order line, brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
What LL-37 is
LL-37 is the 37-residue human cathelicidin peptide, [LL-37, 37 aa], average mass 4493.3, named for its two N-terminal leucines and its length. It is strongly basic, with eleven lysines or arginines against five acidic residues, and amphipathic, folding into a helix that puts its hydrophobic face on one side.
It has no methionine, cysteine or tryptophan, so oxidation is not its problem; one asparagine and one glutamine deamidate slowly. Being both hydrophobic on one face and highly charged, it adsorbs to glass and plastic. Takes many charges in electrospray.
LL-37 beside TB-500 and Thymosin Alpha-1
Its neighbours: TB-500 at $1.034 per mg at 10mg (TB10), 4,963.5 g/mol, acidic overall, at about -3, for all its nine lysines; Thymosin Alpha-1 at $2.170 per mg at 10mg (TA10), 3,108.3 g/mol, net -6, as acidic as LL-37 is basic.
Reading an LL-37 certificate of analysis (COA)
Identity by mass. Average mass 4493.3 (C205H340N60O53). In electrospray the protonated ions come near m/z 4494.3 (singly charged), m/z 2247.7 (doubly charged), m/z 1498.8 (3x charged), m/z 1124.3 (4x charged); on our certificates the measured mass is matched to the calculated average mass, within about one unit.
- Oxidation: no methionine, tryptophan or cysteine in the chain, so oxidised forms are not the impurity to expect.
- Deamidation: 1 asparagine and 1 glutamine. The deamidated form is 0.984 heavier and a little more negatively charged, inside the tolerance of the average-mass line; telling it apart takes a high-resolution mass, which the certificate does not carry.
- Charge: near neutral pH about +6, basic, with 11 basic residues, so it takes multiple charges in electrospray.
- Adsorbs to glass and plastic surfaces.
Worked out from what the sheet holds for this line; the batch certificate is the record. How to read one, and verify a batch number.
Buy LL-37 in bulk
LL-37 is sold in bulk by the sealed box of ten vials, and every account starts at list price. Two discounts can lower it, the size of one order (from $5,000 of goods) or the account’s tier (from lifetime paid spend), and the better one applies, never both. Priced below on 375, 5mg x 10 vials.
| Discount | Earned by | Off goods | 375 per box | Per mg |
|---|---|---|---|---|
| List | Every account, any order | none | $46.75 | $0.935 |
| Order size | $5,000 of goods in one order | 5% | $44.41 | $0.888 |
| Order size | $10,000 of goods in one order | 10% | $42.08 | $0.842 |
| Order size | $20,000 of goods in one order | 15% | $39.74 | $0.795 |
| Order size | $50,000 of goods in one order | 20% | $37.40 | $0.748 |
| Silver tier | $5,000 lifetime paid spend | 3% | $45.35 | $0.907 |
| Gold tier | $15,000 lifetime paid spend | 6% | $43.95 | $0.879 |
| Platinum tier | $50,000 lifetime paid spend | 10% | $42.08 | $0.842 |
| Diamond tier | $100,000 lifetime paid spend | 15% | $39.74 | $0.795 |
Thresholds in USD on goods, before freight; the discount is worked out at checkout and shown on the proforma.
Specification
The limits this compound is supplied to.
| Purity | ≥ 98.0 % (RP-HPLC, 220 nm, area normalisation) |
|---|---|
| Identity | ESI-MS against a calculated average mass of 4493.3 |
| Any single related substance | ≤ 1.0 % |
| Water | ≤ 8.0 % (Karl Fischer) |
| Acetate | ≤ 15.0 % (ion chromatography), as the acetate salt |
| Residual solvents | Acetonitrile ≤ 410 ppm; TFA ≤ 1.0 % |
| Net content | Label claim ± 5 % |
| Closure | 2 mL glass vial, bromobutyl stopper, aluminium flip-off seal |
| Storage | −20 °C, dark and dry; brief ambient transit tolerated |
| Shelf life | 24 months from manufacture; retest date on the batch record |
Order LL-37
50 boxes of 375, 5mg x 10 vials, $46.75 a box.
Questions about LL-37
What are LL-37’s sequence, formula, molecular weight and CAS number?
LLGDFFRKSK EKIGKEFKRI VQRIKDFLRN LVPRTES, 37 residues, the chain named for its two N-terminal leucines and its length: C205H340N60O53, molecular weight (average mass) 4,493.3, CAS 154947-66-7.
Where does LL-37 sit beside TB-500 and thymosin alpha-1?
Between them by mass: at 4,493.3 it is 470.2 lighter than TB-500, 4,963.5, and 1,385.0 heavier than thymosin alpha-1, 3,108.3. TB-500 alone of the three carries a methionine, at 6, which is where its sulfoxide forms; LL-37’s 37 residues include no methionine, no cysteine and no tryptophan, and thymosin alpha-1’s 28 lack all three as well.
How much does LL-37 cost?
It is sold only by special order, 50 boxes per strength, at $46.75 a sealed box of 10 vials, which works out at $0.935 per mg. The smallest order is 50 boxes of 375, $2,337.50 of goods, with freight included to a US address. The price per vial is in this page’s price table.
What does LL-37 cost per mg?
It is offered in one size, 375 at 5mg x 10 vials, which works out at $0.935 per mg at $46.75 a sealed box of 10 vials, sold by special order with a 50-box minimum. Freight included to US addresses from $1,000 of goods.
Can I buy a single vial of LL-37?
No, and not a single box either. LL-37 is a special-order line, brought in on a 50-box minimum rather than held in stock, so the smallest order is 50 sealed boxes of one strength: for 375, 5mg x 10 vials, that is 50 boxes at $46.75, $2,337.50 of goods. A box is sealed at fill with its batch number on it, and splitting one would break the link between the vials and their certificate.
Is LL-37 in stock today?
No. 375 is special order: brought in on a 50-box minimum rather than held in stock; ask the desk for the date before ordering.
How is LL-37 stored?
At minus 20 degrees Celsius, dark and dry. Lyophilised powder tolerates a short spell at ambient temperature in transit, which is why boxes ship without ice. Storage and handling.
What is in a box of LL-37?
Ten sealed vials of one strength, each labelled with the product code, the strength and the batch number; the trade also calls a box a 10-vial kit. LL-37 is supplied as a powder in a sealed glass vial and in no other presentation. Boxes are not split.
Is a certificate of analysis (COA) provided for LL-37?
Yes. For LL-37 the batch certificate reports its purity, net content and identity by mass spectrometry. The other lines on this page are the specification it is made to, and the desk answers for them on a particular batch. The certificate is sent with the shipment, and again on request, and any batch number can be verified on the certificate page.
Is this for human use?
No. Everything here is supplied for laboratory research only, to trade accounts, and is not for human or animal consumption. The research-use page sets out who can buy and what is not sold.